COASY Rabbit Polyclonal Antibody

CAT#: TA331317

Rabbit Polyclonal Anti-COASY Antibody

Product Images

WB Suggested Anti-COASY Antibody; Titration: 1.0 ug/ml; Positive Control: A549 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-COASY antibody is: synthetic peptide directed towards the C-terminal region of Human COASY. Synthetic peptide located within the following region: ETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: Coenzyme A synthase
• Database Link:
  NP_001035997
  Entrez Gene 80347 Human
  UniProt ID Q13057
• Background: Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. COASY is a bifunctional enzyme that catalyzes the 2 last steps in CoA synthesis. These activities are performed by 2 separate enzymes, phosphopantetheine adenylyltransferase and dephospho-CoA kinase, in prokaryotes.
• Synonyms: DPCK; NBIA6; NBP; pOV-2; PPAT; UKR1
• Note: Pig: 100%; Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92%; Bovine: 86%; Dog: 83%

Reference Data

• Protein Pathways: Metabolic pathways, Pantothenate and CoA biosynthesis