STK32C Rabbit Polyclonal Antibody

CAT#: TA331397

Rabbit polyclonal Anti-STK32A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "STK32C"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-STK32A antibody is: synthetic peptide directed towards the N-terminal region of Human STK32A. Synthetic peptide located within the following region: PVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name serine/threonine kinase 32C
Background STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.
Synonyms PKE; YANK3
Note Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 85%; Rabbit: 85%; Dog: 77%; Bovine: 77%
Reference Data
Protein Families Druggable Genome, Protein Kinase

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.