Foxo6 Rabbit Polyclonal Antibody

CAT#: TA331437

Rabbit polyclonal Anti-FOXO6 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Foxo6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FOXO6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 61 kDa
Gene Name forkhead box O6
Background Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of which is important in embryonic development. These forkhead transcription factors may play a role in maintenance and survival of developing and adult neurons.
Synonyms Foxo6
Note Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Human: 86%; Guinea pig: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.