Mafa Rabbit Polyclonal Antibody

CAT#: TA331438

Rabbit polyclonal Anti-Mafa Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Mafa"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian)
Background Mafa acts as a transcriptional factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context.
Synonyms hMafA; RIPE3b1
Note Rat: 100%; Mouse: 100%; Human: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.