Mafa Rabbit Polyclonal Antibody
Other products for "Mafa"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian) |
Database Link | |
Background | Mafa acts as a transcriptional factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context. |
Synonyms | hMafA; RIPE3b1 |
Note | Rat: 100%; Mouse: 100%; Human: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.