Mafa Rabbit Polyclonal Antibody

CAT#: TA331439

Rabbit polyclonal Anti-Mafa Antibody

Product Images

WB Suggested Anti-Mafa Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian)
• Database Link:
  NP_919331
  Entrez Gene 378435 Mouse
  UniProt ID Q8CF90
• Background: Mafa acts as a transcriptional factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context.
• Synonyms: hMafA; RIPE3b1
• Note: Rat: 100%; Mouse: 100%; Bovine: 79%