Zhx2 Rabbit Polyclonal Antibody

CAT#: TA331444

Rabbit polyclonal Anti-ZHX2 Antibody

Product Images

WB Suggested Anti-ZHX2 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZHX2 antibody: synthetic peptide directed towards the C terminal of mouse ZHX2. Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: zinc fingers and homeoboxes 2
• Database Link:
  NP_955520
  Entrez Gene 387609 Mouse
  UniProt ID Q8C0C0
• Background: ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indirectly, e.g., by regulating the synthesis of a hormone that controls AFP synthesis.
• Synonyms: AFR1; KIAA0854; RAF
• Note: Rat: 100%; Mouse: 100%; Pig: 93%; Dog: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%; Human: 79%