KCNMA1 Rabbit Polyclonal Antibody

CAT#: TA331455

Rabbit polyclonal Anti-KCNMA1 Antibody

Product Images

WB Suggested Anti-KCNMA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1. Synthetic peptide located within the following region: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 131 kDa
• Gene Name: potassium calcium-activated channel subfamily M alpha 1
• Database Link:
  NP_002238
  Entrez Gene 3778 Human
  UniProt ID Q12791
• Background: This protein is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: bA205K10.1; BKTM; hSlo; KCa1.1; MaxiK; mSLO1; SAKCA; SLO; SLO-ALPHA; SLO1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane
• Protein Pathways: Vascular smooth muscle contraction