ARA9 (AIP) Rabbit Polyclonal Antibody

CAT#: TA331482

Rabbit polyclonal Anti-AIP Antibody

Product Images

WB Suggested Anti-AIP Antibody Titration: 1.25ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysateAIP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: PLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: aryl hydrocarbon receptor interacting protein
• Database Link:
  NP_003968
  Entrez Gene 9049 Human
  UniProt ID O00170
• Background: AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein.
• Synonyms: ARA9; FKBP16; FKBP37; SMTPHN; XAP-2; XAP2
• Note: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 92%; Sheep: 83%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors