SH3D20 Rabbit Antibody

CAT#: TA331509

Rabbit Polyclonal Anti-ARHGAP27 Antibody

Specifications

Product Data

• Reactivities: Human, Mouse, Rat, Dog, Pig, Horse, Rabbit, Bovine
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-ARHGAP27 Antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGAP27. Synthetic peptide located within the following region: GVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPS
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Database Link:
  NP_954976
  Entrez Gene 201176 Human
• Background: Rho-like small GTPases are involved in many cellular processes, and they are inactive in the GDP-bound state and active in the GTP-bound state. GTPase-activating proteins, such as ARHGAP27, inhibit Rho-like proteins by stimulating their intrinsic GTPase activity.
• Synonyms: CAMGAP1; PP905; SH3D20; SH3P20
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%