CCDC39 Rabbit Antibody

CAT#: TA331555

Rabbit Polyclonal Anti-CCDC39 Antibody

Specifications

Product Data

• Reactivities: Human, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Bovine
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-CCDC39 Antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC39. Synthetic peptide located within the following region: QELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILE
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Database Link:
  NP_852091
  Entrez Gene 339829 Human
• Background: The function of this protein remains unknown.
• Synonyms: CILD14; FAP59
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%