DTX3 Rabbit Polyclonal Antibody

CAT#: TA331561

Rabbit Polyclonal Anti-Dtx3 Antibody

Product Images

WB Suggested Anti-Dtx3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Dtx3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: deltex 3, E3 ubiquitin ligase
• Database Link:
  NP_848597
  Entrez Gene 80904 Mouse
  UniProt ID Q8N9I9
• Background: Dtx3 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Dtx3 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Dtx3 functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.
• Synonyms: deltex3; RNF154
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Notch signaling pathway