Germany
Japan
United Kingdom
China
Goat Anti-DTX3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KNKVTVSKPVWD, from the internal region (near N Terminus) of the protein sequence according to NP_848597.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Dtx3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Dtx3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL |
Anti-DTX3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 248 amino acids of human deltex homolog 3 (Drosophila) |
Anti-DTX3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 248 amino acids of human deltex homolog 3 (Drosophila) |
DTX3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DTX3 |
Active filters
Target Symbol
- DTX3