DLX1 Rabbit Polyclonal Antibody

CAT#: TA331568

Rabbit Polyclonal Anti-DLX1 Antibody

Product Images

WB Suggested Anti-DLX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DLX1 Antibody: synthetic peptide directed towards the C terminal of human DLX1. Synthetic peptide located within the following region: KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: distal-less homeobox 1
• Database Link:
  NP_835221
  Entrez Gene 1745 Human
  UniProt ID P56177
• Background: DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
• Synonyms: distal-less homeo box 1; distal-less homeobox 1; OTTHUMP00000082494; OTTHUMP00000082497
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors