Aprataxin Rabbit Polyclonal Antibody

CAT#: TA331579

Rabbit Polyclonal Anti-APTX Antibody

USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "APTX"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-APTX Antibody: synthetic peptide directed towards the middle region of human APTX. Synthetic peptide located within the following region: YPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Background APTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined. This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
Synonyms AOA; AOA1; aprataxin; ataxia 1; AXA1; EAOH; early onset with hypoalbuminemia; EOAHA; FHA-HIT; FLJ20157; MGC1072; OTTHUMP00000021188
Note Immunogen sequence homology: Human: 100%; Horse: 92%; Dog: 86%; Rabbit: 86%; Pig: 79%; Guinea pig: 79%; Bovine: 77%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.