Aprataxin Rabbit Polyclonal Antibody

CAT#: TA331580

Rabbit Polyclonal Anti-APTX Antibody

Product Images

WB Suggested Anti-APTX Antibody Titration: 1.25ug/ml; ELISA Titer: 1: 1562500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-APTX Antibody: synthetic peptide directed towards the N terminal of human APTX. Synthetic peptide located within the following region: MMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQLKAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Database Link:
  NP_778241
  Entrez Gene 54840 Human
• Background: APTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. APTX may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
• Synonyms: AOA; AOA1; aprataxin; ataxia 1; AXA1; EAOH; early onset with hypoalbuminemia; EOAHA; FHA-HIT; FLJ20157; MGC1072; OTTHUMP00000021188
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Dog: 85%

Reference Data

• Protein Families: Druggable Genome