Fa2h Rabbit Polyclonal Antibody
CAT#: TA331746
Rabbit Polyclonal Anti-Fa2h Antibody
Other products for "Fa2h"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Fa2h Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 43 kDa |
Database Link | |
Background | Fa2h is required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Zebrafish: 92%; Bovine: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.