5HT5A receptor (HTR5A) Rabbit Polyclonal Antibody

CAT#: TA331757

Rabbit Polyclonal Anti-HTR5A Antibody

Product Images

WB Suggested Anti-HTR5A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HTR5A Antibody: synthetic peptide directed towards the N terminal of human HTR5A. Synthetic peptide located within the following region: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: 5-hydroxytryptamine receptor 5A
• Database Link:
  NP_076917
  Entrez Gene 3361 Human
  UniProt ID P47898
• Background: The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. HTR5A is a member of 5-hydroxytryptamine (serotonin) receptor family. It is a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization.
• Synonyms: 5-HT5A
• Note: Immunogen sequence homology: Human: 100%; Pig: 85%; Guinea pig: 85%; Rat: 79%; Horse: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction