SEMA4A Rabbit Polyclonal Antibody

CAT#: TA331773

Rabbit Polyclonal Anti-SEMA4A Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SEMA4A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SEMA4A Antibody: synthetic peptide directed towards the N terminal of human SEMA4A. Synthetic peptide located within the following region: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 84 kDa
Gene Name semaphorin 4A
Background SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.
Synonyms CORD10; RP35; SEMAB; SEMB
Note Immunogen sequence homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%
Reference Data
Protein Families Transmembrane
Protein Pathways Axon guidance

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.