PRDM16 Rabbit Polyclonal Antibody

CAT#: TA331779

Rabbit Polyclonal Anti-PRDM16 Antibody

Product Images

WB Suggested Anti-PRDM16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRDM16 Antibody: synthetic peptide directed towards the middle region of human PRDM16. Synthetic peptide located within the following region: LNHTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGPEEKFESRLEDSCV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 140 kDa
• Gene Name: PR domain 16
• Database Link:
  NP_071397
  Entrez Gene 63976 Human
  UniProt ID Q9HAZ2
• Background: The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Synonyms: CMD1LL; LVNC8; MEL1; PFM13
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Bovine: 92%; Rat: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 79%; Dog: 77%