ALX4 Rabbit Polyclonal Antibody

CAT#: TA331782

Rabbit Polyclonal Anti-ALX4 Antibody

Product Images

WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the middle region of human ALX4. Synthetic peptide located within the following region: GQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: ALX homeobox 4
• Database Link:
  NP_068745
  Entrez Gene 60529 Human
  UniProt ID Q9H161
• Background: ALX4 is a member of the ALX homeobox gene family in humans. The paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members.
• Synonyms: CRS5; FND2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%

Reference Data

• Protein Families: Druggable Genome