ALX4 Rabbit Polyclonal Antibody

CAT#: TA331783

Rabbit Polyclonal Anti-ALX4 Antibody

Product Images

WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: ALX homeobox 4
• Database Link:
  NP_068745
  Entrez Gene 60529 Human
  UniProt ID Q9H161
• Background: Alx4 is a member of the family of transcription factors that contain the paired-type homeodomain. In contrast to other types of homeodomains, the paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members. Alx4 is co-expressed with Cart1 at several sites during development, including the craniofacial mesenchyme, the mesenchymal derivatives of neural crest cells in the first branchial arch and the limb bud mesenchyme.
• Synonyms: CRS5; FND2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome