RAB18 Rabbit Polyclonal Antibody

CAT#: TA331791

Rabbit Polyclonal Anti-RAB18 Antibody

Product Images

WB Suggested Anti-RAB18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RAB18 Antibody: synthetic peptide directed towards the C terminal of human RAB18. Synthetic peptide located within the following region: LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: RAB18, member RAS oncogene family
• Database Link:
  NP_067075
  Entrez Gene 22931 Human
  UniProt ID Q9NP72
• Background: RAB18 belongs to the small GTPase superfamily.The protein plays a role in apical endocytosis/recycling and may be implicated in transport between the plasma membrane and early endosomes
• Synonyms: RAB18LI1; WARBM3
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Goat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome