Scramblase 1 (PLSCR1) Rabbit Polyclonal Antibody

CAT#: TA331804

Rabbit Polyclonal Anti-PLSCR1 Antibody

Product Images

Host: Rabbit; Target Name: PLSCR1; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml; PLSCR1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLSCR1 Antibody is: synthetic peptide directed towards the middle region of Human PLSCR1. Synthetic peptide located within the following region: TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: phospholipid scramblase 1
• Database Link:
  NP_066928
  Entrez Gene 5359 Human
  UniProt ID O15162
• Background: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
• Synonyms: MMTRA1B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 82%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency