TBX20 Rabbit Polyclonal Antibody

CAT#: TA331828

Rabbit Polyclonal Anti-TBX20 Antibody

Product Images

Host: Rabbit; Target Name: TBX20; Sample Tissue: Jurkat cell lysates; Antibody Dilution: 1.0ug/ml

• 

  Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TBX20 antibody

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBX20 Antibody: synthetic peptide directed towards the N terminal of human TBX20. Synthetic peptide located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: T-box 20
• Database Link:
  NP_065150
  Entrez Gene 57057 Human
  UniProt ID Q9UMR3
• Background: TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.
• Synonyms: 9430010M06Rik; AL022859; ASD4; T-box 20; Tbx12
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors