CDC42SE2 Rabbit Polyclonal Antibody

CAT#: TA331833

Rabbit Polyclonal Anti-CDC42SE2 Antibody

Product Images

Host: Rabbit; Target Name: CDC42SE2; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CDC42SE2 Antibody is: synthetic peptide directed towards the middle region of Human CDC42SE2. Synthetic peptide located within the following region: NFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 9 kDa
• Gene Name: CDC42 small effector 2
• Database Link:
  NP_064625
  Entrez Gene 56990 Human
  UniProt ID Q9NRR3
• Background: CDC42SE2 is probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. It alters CDC42-induced cell shape changes. In activated T-cells, CDC42SE2 may play a role in CDC42-mediated F-actin accumulation at the immunological synapse and may play a role in early contractile events in phagocytosis in macrophages.
• Synonyms: SPEC2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome