BBX Rabbit Polyclonal Antibody

CAT#: TA331834

Rabbit Polyclonal Anti-BBX Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-BBX Antibody: synthetic peptide directed towards the middle region of human BBX. Synthetic peptide located within the following region: KKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 101 kDa
Gene Name bobby sox homolog (Drosophila)
Background BBX is a transcription factor that is necessary for cell cycle progression from G1 to S phase.
Synonyms ARTC1; HBP2; HSPC339; MDS001
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.