Rabbit Polyclonal Anti-BBX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BBX antibody: synthetic peptide directed towards the middle region of human BBX. Synthetic peptide located within the following region: VSAFFSLAALAEVAAMENVHRGQRSTPLTHDGQPKEMPQAPVLISCADQ |
Rabbit Polyclonal Anti-BBX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BBX Antibody: synthetic peptide directed towards the middle region of human BBX. Synthetic peptide located within the following region: KKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHK |
BBX Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human BBX |
BBX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BBX |
Germany
Japan
United Kingdom
China
