BBX Rabbit Polyclonal Antibody

CAT#: TA345283

Rabbit Polyclonal Anti-BBX Antibody

Product Images

WB Suggested Anti-BBX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BBX antibody: synthetic peptide directed towards the middle region of human BBX. Synthetic peptide located within the following region: VSAFFSLAALAEVAAMENVHRGQRSTPLTHDGQPKEMPQAPVLISCADQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 101 kDa
• Gene Name: bobby sox homolog (Drosophila)
• Database Link:
  NP_064620
  Entrez Gene 56987 Human
  UniProt ID Q8WY36
• Background: BBX is a transcription factor that is necessary for cell cycle progression from G1 to S phase.
• Synonyms: ARTC1; HBP2; HSPC339; MDS001
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors