TAS2R5 Rabbit Polyclonal Antibody

CAT#: TA331843

Rabbit Polyclonal Anti-TAS2R5 Antibody

Product Images

Host: Rabbit; Target Name: TAS2R5; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TAS2R5 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R5. Synthetic peptide located within the following region: SWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: taste 2 receptor member 5
• Database Link:
  NP_061853
  Entrez Gene 54429 Human
  UniProt ID Q9NYW4
• Background: This gene encodes a bitter taste receptor; bitter taste receptors are members of the G protein-coupled receptor superfamily and are specifically expressed by taste receptor cells of the tongue and palate epithelia. Each of these apparently intronless taste receptor genes encodes a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes on chromosome 7 and is genetically linked to loci that influence bitter perception.
• Synonyms: T2R5
• Note: Immunogen sequence homology: Human: 100%; Dog: 83%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Taste transduction