SLC38A2 Rabbit Polyclonal Antibody

CAT#: TA331844

Rabbit Polyclonal Anti-SLC38A2 Antibody

Product Images

WB Suggested Anti-SLC38A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysateSLC38A2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC38A2 Antibody: synthetic peptide directed towards the N terminal of human SLC38A2. Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: solute carrier family 38 member 2
• Database Link:
  NP_061849
  Entrez Gene 54407 Human
  UniProt ID Q96QD8
• Background: Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.
• Synonyms: ATA2; PRO1068; SAT2; SNAT2
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane