ZNF313 (RNF114) Rabbit Polyclonal Antibody

CAT#: TA331847

Rabbit Polyclonal Anti-ZNF313 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RNF114"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF313 Antibody: synthetic peptide directed towards the N terminal of human ZNF313. Synthetic peptide located within the following region: AVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name ring finger protein 114
Background ZNF313 may play a role in spermatogenesis
Synonyms PSORS12; ZNF313
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 92%; Yeast: 75%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.