YOD1 Rabbit Polyclonal Antibody

CAT#: TA331854

Rabbit Polyclonal Anti-YOD1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "YOD1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-YOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human YOD1. Synthetic peptide located within the following region: ELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name YOD1 deubiquitinase
Background Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA8 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
Synonyms DUBA8; OTUD2; PRO0907
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Mouse: 86%
Reference Data
Protein Pathways Biosynthesis of unsaturated fatty acids, Limonene and pinene degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.