E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody

CAT#: TA331936

Rabbit Polyclonal Anti-PIAS4 Antibody

Product Images

WB Suggested Anti-PIAS4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PIAS4 Antibody: synthetic peptide directed towards the N terminal of human PIAS4. Synthetic peptide located within the following region: AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: protein inhibitor of activated STAT 4
• Database Link:
  NP_056981
  Entrez Gene 51588 Human
  UniProt ID Q8N2W9
• Background: PIAS4 is an inhibitor of TRIF-induced ISRE and NF-kappaB activation. Its mRNA is selectively expressed in endothelial cells, and its expression can be regulated by angiogenic growth factors
• Synonyms: PIAS-gamma; Piasg; PIASY; ZMIZ6
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Jak-STAT signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis