PPAR gamma (PPARG) Rabbit Polyclonal Antibody

CAT#: TA331938

Rabbit Polyclonal Anti-PPARG Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PPARG"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution IHC, WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name peroxisome proliferator activated receptor gamma
Background PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.
Synonyms CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARgamma
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Bovine: 93%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.