PLEKHG3 Rabbit Polyclonal Antibody

CAT#: TA331945

Rabbit Polyclonal Anti-PLEKHG3 Antibody

Product Images

Host: Rabbit; Target Name: PLEKHG3; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml; PLEKHG3 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLEKHG3 Antibody is: synthetic peptide directed towards the C-terminal region of Human PLEKHG3. Synthetic peptide located within the following region: PGGRPSARSPLSPTETFSWPDVRELCSKYASRDEARRAGGGRPRGPPVNR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 128 kDa
• Gene Name: pleckstrin homology and RhoGEF domain containing G3
• Database Link:
  NP_056364
  Entrez Gene 26030 Human
  UniProt ID A1L390
• Background: The function of this protein remains unknown.
• Synonyms: ARHGEF43; KIAA0599
• Note: Immunogen sequence homology: Human: 100%