L3MBTL1 Rabbit Polyclonal Antibody

CAT#: TA331951

Rabbit Polyclonal Anti-L3MBTL Antibody

Product Images

WB Suggested Anti-L3MBTL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-L3MBTL Antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: RRREGHGTDSEMGQGPVRESQSSDPPALQFRISEYKPLNMAGVEQPPSPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: l(3)mbt-like 1 (Drosophila)
• Database Link:
  NP_056293
  Entrez Gene 26013 Human
  UniProt ID Q9Y468
• Background: L3MBTL is the homolog of a protein identified in Drosophila as a suppressor of malignant transformation of neuroblasts and ganglion-mother cells in the optic centers of the brain. L3MBTL is localized to condensed chromosomes in mitotic cells. Overexpression of this gene in a glioma cell line results in improper nuclear segregation and cytokinesis producing multinucleated cells.This gene encodes the homolog of a protein identified in Drosophila as a suppressor of malignant transformation of neuroblasts and ganglion-mother cells in the optic centers of the brain. This gene product is localized to condensed chromosomes in mitotic cells. Overexpression of this gene in a glioma cell line results in improper nuclear segregation and cytokinesis producing multinucleated cells. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: dJ138B7.3; H-L(3)MBT; L3MBTL; ZC2HC3
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Transcription Factors