ABCB10 Rabbit Polyclonal Antibody

CAT#: TA332000

Rabbit Polyclonal Anti-Abcb10 Antibody

Product Images

WB Suggested Anti-Abcb10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Rat Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: ATP binding cassette subfamily B member 10
• Database Link:
  NP_036221
  Entrez Gene 361439 Rat
  UniProt ID Q9NRK6
• Background: Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
• Synonyms: EST20237; M-ABC2; MTABC2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Yeast: 92%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters