CYP46 (CYP46A1) Rabbit Polyclonal Antibody

CAT#: TA332027

Rabbit Polyclonal Anti-CYP46A1 Antibody

Product Images

WB Suggested Anti-CYP46A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

• 

  2Hum. Adult Placenta; Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cytochrome P450 family 46 subfamily A member 1
• Database Link:
  NP_006659
  Entrez Gene 10858 Human
  UniProt ID Q9Y6A2
• Background: CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CP46; CYP46
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, P450
• Protein Pathways: Primary bile acid biosynthesis