PC6 (PCSK5) Rabbit Polyclonal Antibody

CAT#: TA332044

Rabbit Polyclonal Anti-PCSK5 Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "PCSK5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PCSK5 Antibody: synthetic peptide directed towards the middle region of human PCSK5. Synthetic peptide located within the following region: CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 89 kDa
Gene Name proprotein convertase subtilisin/kexin type 5
Background PCSK5 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. PCSK5 mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known.The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms PC5; PC6; PC6A; SPC6
Note Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Mouse: 86%; Rat: 79%
Reference Data
Protein Families Druggable Genome, Protease, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.