ENTPD6 Rabbit Polyclonal Antibody

CAT#: TA332148

Rabbit Polyclonal Anti-ENTPD6 Antibody

Product Images

Host: Rabbit; Target Name: ENTPD6; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: ectonucleoside triphosphate diphosphohydrolase 6 (putative)
• Database Link:
  NP_001238
  Entrez Gene 955 Human
  UniProt ID O75354
• Background: The function of this protein remains unknown.
• Synonyms: CD39L2; dJ738P15.3; IL-6SAG; IL6ST2; NTPDase-6
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Rat: 86%; Horse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: Purine metabolism, Pyrimidine metabolism