Spcs2 Rabbit Polyclonal Antibody

CAT#: TA332154

Rabbit Polyclonal Anti-Spcs2 Antibody

Product Images

Host: Rabbit; Target Name: Spcs2; Sample Tissue: Rat Lung lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Spcs2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Spcs2. Synthetic peptide located within the following region: GTSSSRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: signal peptidase complex subunit 2
• Database Link:
  NP_001178530
  Entrez Gene 293142 Rat
• Background: The function of this protein remains unknown.
• Synonyms: KIAA0102; MGC117366; SPC25
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%