KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody

CAT#: TA332173

Rabbit Polyclonal Anti-JMJD1A Antibody

Product Images

WB Suggested Anti-JMJD1A Antibody Titration: 1.0ug/ml; Positive Control: Jurkat cell lysateKDM3A is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human Smooth Muscle

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-JMJD1A Antibody: synthetic peptide directed towards the C terminal of human JMJD1A. Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 147 kDa
• Gene Name: lysine demethylase 3A
• Database Link:
  NP_001140160
  Entrez Gene 55818 Human
  UniProt ID Q9Y4C1
• Background: JMJD1A is a zinc finger protein that contains a jumonji domain.
• Synonyms: JHDM2A; JHMD2A; JMJD1; JMJD1A; TSGA
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%