TDRD12 Rabbit Polyclonal Antibody

CAT#: TA332195

Rabbit Polyclonal Anti-TDRD12 Antibody

Product Images

Host: Rabbit; Target Name: TDRD12; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml; TDRD12 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TDRD12 Antibody is: synthetic peptide directed towards the C-terminal region of Human TDRD12. Synthetic peptide located within the following region: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: tudor domain containing 12
• Database Link:
  NP_001104292
  Entrez Gene 91646 Human
  UniProt ID Q587J7
• Background: The function of this protein remains unknown.
• Synonyms: ECAT8
• Note: Immunogen sequence homology: Human: 100%; Pig: 86%; Horse: 86%; Bovine: 86%