AKR1B15 Rabbit Polyclonal Antibody

CAT#: TA332216

Rabbit Polyclonal Anti-AKR1B15 Antibody

Product Images

Host: Rabbit; Target Name: AKR1B15; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AKR1B15 Antibody is: synthetic peptide directed towards the C-terminal region of Human AKR1B15. Synthetic peptide located within the following region: TAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: aldo-keto reductase family 1, member B15
• Database Link:
  NP_001074007
  Entrez Gene 441282 Human
  UniProt ID C9JRZ8
• Background: AKR1B15 possesses weak oxidoreductase activity.
• Synonyms: AK1R1B7; AKR1B10L; AKR1R1B7
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 92%; Dog: 86%; Rabbit: 86%; Zebrafish: 86%; Yeast: 79%