FRMPD2 Rabbit Polyclonal Antibody

CAT#: TA332255

Rabbit Polyclonal Anti-FRMPD2 Antibody

Product Images

Host: Rabbit; Target Name: FRMPD2; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FRMPD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human FRMPD2. Synthetic peptide located within the following region: LLQGQSEDEQPDASQMHVYSLGMTLYWSAGFHVPPHQPLQLCEPLHSILL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: FERM and PDZ domain containing 2
• Database Link:
  NP_001018081
  Entrez Gene 143162 Human
  UniProt ID Q68DX3
• Background: This gene encodes a peripheral membrane protein and is located in a region of chromosome 10q that contains a segmental duplication. This copy of the gene is full-length and is in the telomeric duplicated region. Two other more centromerically proximal copies of the gene are partial and may represent pseudogenes. This full-length gene appears to function in the establishment and maintenance of cell polarization. The protein is recruited to cell-cell junctions in an E-cadherin-dependent manner, and is selectively localized at the basolateral membrane in polarized epithelial cells. Alternative splicing results in multiple transcript variants.
• Synonyms: PDZD5C; PDZK4; PDZK5C
• Note: Immunogen sequence homology: Human: 100%; Pig: 86%; Bovine: 79%; Guinea pig: 79%; Horse: 77%