Fam110a Rabbit Polyclonal Antibody

CAT#: TA332258

Rabbit Polyclonal Anti-Fam110a Antibody

Product Images

Host: Rabbit; Target Name: Fam110a; Sample Tissue: Rat Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fam110a Antibody is: synthetic peptide directed towards the C-terminal region of Rat Fam110a. Synthetic peptide located within the following region: SPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: family with sequence similarity 110, member A
• Database Link:
  NP_001014072
  Entrez Gene 311535 Rat
• Background: The function of this protein remains unknown.
• Synonyms: bA371L19.3; C20orf55; F10; MGC2450; MGC4675; OTTHUMP00000029943; OTTHUMP00000029944; OTTHUMP00000029945
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 83%; Zebrafish: 75%