STEAP3 Rabbit Polyclonal Antibody

CAT#: TA332278

Rabbit Polyclonal Anti-STEAP3 Antibody

Product Images

WB Suggested Anti-STEAP3 Antibody Titration: 5.0ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the N terminal of human STEAP3. Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: STEAP3 metalloreductase
• Database Link:
  NP_001008410
  Entrez Gene 55240 Human
  UniProt ID Q658P3
• Background: AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT
• Synonyms: AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Pig: 92%; Bovine: 86%; Guinea pig: 86%; Dog: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: p53 signaling pathway