C10orf90 Rabbit Polyclonal Antibody

CAT#: TA332331

Rabbit Polyclonal Anti-C10orf90 Antibody

Product Images

Host: Rabbit; Target Name: C10orf90; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C10orf90 Antibody is: synthetic peptide directed towards the C-terminal region of Human C10orf90. Synthetic peptide located within the following region: QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: chromosome 10 open reading frame 90
• Database Link:
  NP_001004298
  Entrez Gene 118611 Human
  UniProt ID Q96M02
• Background: C10orf90 is a tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. It mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. It may have a role in the assembly of primary cilia.
• Synonyms: bA422P15.2; FATS
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Pig: 85%; Guinea pig: 85%; Mouse: 79%