SYT homolog 1 (SS18L1) Rabbit Polyclonal Antibody

CAT#: TA333342

Rabbit Polyclonal Anti-SS18L1 Antibody

Product Images

WB Suggested Anti-SS18L1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateSS18L1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SS18L1 Antibody: synthetic peptide directed towards the middle region of human SS18L1. Synthetic peptide located within the following region: EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: SS18L1, nBAF chromatin remodeling complex subunit
• Database Link:
  NP_945173
  Entrez Gene 26039 Human
  UniProt ID O75177
• Background: The specific functin of this protein remains unknown.Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L1 gene is homologous to SS18.
• Synonyms: CREST; LP2261
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 79%