Tmem110 Rabbit Polyclonal Antibody

CAT#: TA333344

Rabbit Polyclonal Anti-Tmem110 Antibody

Product Images

WB Suggested Anti-Tmem110 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tmem110 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: VGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: transmembrane protein 110
• Database Link:
  NP_942069
  Entrez Gene 361110 Rat
  UniProt ID Q7TSW6
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp667E1121; MGC52022
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%